(data stored in ACNUC7421 zone)

EMBL: CP000272.PE399

CP000272.PE399       Location/Qualifiers
FT   CDS             complement(447063..448010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0423"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36327"
FT                   /db_xref="GOA:Q13HW2"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW2"
FT                   /protein_id="ABE36327.1"
FT                   /translation="MSATPLPSVLSLSGVASSLPVRTVDANIWARRCGFPEARANALLK
FT                   NGVQQFHDATATSPVAFACEAVSALLEDTGTTPASIDALIYTHTIQSNVLAPPAGTAAF
FT                   IQSRLGLERALAFSVMQQNCVSPMAAVHLLRMLTVAGRPIQRAIVVCADVMGSGCDHLR
FT                   AIQDLALHSDGACALLLERCVDRNCIVGLHLYTDARYFRGTDDDLQPVPDDRYYWSAFT
FT                   TMRAALGQAGITGSQLVRVLPHHVNLPGWSRLMTMLSAPQERLFTAGFGRLGHVFGADP
FT                   FINFHTAPRGEPGSHSLLFSSGLAGCFGAMVIRH"
     MSATPLPSVL SLSGVASSLP VRTVDANIWA RRCGFPEARA NALLKNGVQQ FHDATATSPV        60
     AFACEAVSAL LEDTGTTPAS IDALIYTHTI QSNVLAPPAG TAAFIQSRLG LERALAFSVM       120
     QQNCVSPMAA VHLLRMLTVA GRPIQRAIVV CADVMGSGCD HLRAIQDLAL HSDGACALLL       180
     ERCVDRNCIV GLHLYTDARY FRGTDDDLQP VPDDRYYWSA FTTMRAALGQ AGITGSQLVR       240
     VLPHHVNLPG WSRLMTMLSA PQERLFTAGF GRLGHVFGAD PFINFHTAPR GEPGSHSLLF       300
     SSGLAGCFGA MVIRH                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page