(data stored in ACNUC7421 zone)

EMBL: CP000272.PE400

CP000272.PE400       Location/Qualifiers
FT   CDS             complement(448013..449047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0424"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36328"
FT                   /db_xref="GOA:Q13HW1"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW1"
FT                   /protein_id="ABE36328.1"
FT                   /translation="MYIATDHGHGQICIASTARYVPKARVHPEALPQKPVATAISMRDA
FT                   VMRSVHADTLRWRQQATPSVAANHPSRSVHPAMPAHVASEPHLSLSEMASAVAGEAIRR
FT                   YPSKEDHAPDQIIVCGTSLEHDLALSCAGRLHSELGSTGVPFAIGQIQGVSFFLALQVA
FT                   ADMMASDERMHTTLIVAAERWLPPFSRQTGSLTVLADGAAAILVSRGSCPGWHVRSLTV
FT                   CTPCTSVSIPPQDIRIDEAAVVEVIGQTCAQAGVKPTTFDWIVPPRINTTLACNVSAEA
FT                   RLPVWRMWYPEPGDIGYLCAADAPAQLHVLLQTVVPANGQRILLWSAGFQGQAACAVLE
FT                   YHGR"
     MYIATDHGHG QICIASTARY VPKARVHPEA LPQKPVATAI SMRDAVMRSV HADTLRWRQQ        60
     ATPSVAANHP SRSVHPAMPA HVASEPHLSL SEMASAVAGE AIRRYPSKED HAPDQIIVCG       120
     TSLEHDLALS CAGRLHSELG STGVPFAIGQ IQGVSFFLAL QVAADMMASD ERMHTTLIVA       180
     AERWLPPFSR QTGSLTVLAD GAAAILVSRG SCPGWHVRSL TVCTPCTSVS IPPQDIRIDE       240
     AAVVEVIGQT CAQAGVKPTT FDWIVPPRIN TTLACNVSAE ARLPVWRMWY PEPGDIGYLC       300
     AADAPAQLHV LLQTVVPANG QRILLWSAGF QGQAACAVLE YHGR                        344
//

If you have problems or comments...

PBIL Back to PBIL home page