(data stored in ACNUC7421 zone)

EMBL: CP000272.PE401

CP000272.PE401       Location/Qualifiers
FT   CDS             complement(449031..449309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36329"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW0"
FT                   /protein_id="ABE36329.1"
FT                   /translation="MTHDTHGPGREEIATTIRSCLLSAVGSTMAADLIADDTNLFDVGV
FT                   DSMNMTDLLLELEQRFGFTLAPEDLTADLFLRFGNLVSFVESHVHRN"
     MTHDTHGPGR EEIATTIRSC LLSAVGSTMA ADLIADDTNL FDVGVDSMNM TDLLLELEQR        60
     FGFTLAPEDL TADLFLRFGN LVSFVESHVH RN                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page