(data stored in SCRATCH zone)

EMBL: CP000272.PE407

CP000272.PE407       Location/Qualifiers
FT   CDS             454359..455234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0431"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36335"
FT                   /db_xref="GOA:Q13HV4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV4"
FT                   /protein_id="ABE36335.1"
FT                   /translation="MTTILNILGYVSILMLVALGLAVVFGMMDIVNLAHAEWVTIGAYA
FT                   LAIAQAVGGQQAFWLALVVAPAVGAALGWCLERFIIRLLYDRPLDTLLATYAVSLILQK
FT                   VLELIFGTQPMLVYAPFSGVVPVPGGSYPAYRIFVIGVALTVTAGCWLLFACTRVGTQL
FT                   RAVIQHRAMAEATGIDTRRLNRIAFCGGAGLASLAGVLVAPMVSVESHLGVSYLAKAFF
FT                   VIVLGGIGSIAGSILGSAVIGTAETLLSYRVDPSLASAMVLVLSIVVIRFRPQGLIPGF
FT                   SAAHQLLGKG"
     MTTILNILGY VSILMLVALG LAVVFGMMDI VNLAHAEWVT IGAYALAIAQ AVGGQQAFWL        60
     ALVVAPAVGA ALGWCLERFI IRLLYDRPLD TLLATYAVSL ILQKVLELIF GTQPMLVYAP       120
     FSGVVPVPGG SYPAYRIFVI GVALTVTAGC WLLFACTRVG TQLRAVIQHR AMAEATGIDT       180
     RRLNRIAFCG GAGLASLAGV LVAPMVSVES HLGVSYLAKA FFVIVLGGIG SIAGSILGSA       240
     VIGTAETLLS YRVDPSLASA MVLVLSIVVI RFRPQGLIPG FSAAHQLLGK G                291
//

If you have problems or comments...

PBIL Back to PBIL home page