(data stored in ACNUC7421 zone)

EMBL: CP000272.PE408

CP000272.PE408       Location/Qualifiers
FT   CDS             455240..456313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0432"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36336"
FT                   /db_xref="GOA:Q13HV3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV3"
FT                   /protein_id="ABE36336.1"
FT                   /translation="MSGKHAGCLRLWLSQPALGPRDVSALLMWSVAMAAAALVPFFAGP
FT                   WLLSTVRDALVMGILALSYDLLWGRAGVLTLGHTTFLGLGAYGFAVATVQFGQAPVTGL
FT                   VAGVLCAAAVAAVIGYFLLFAGVRLHFFAIISLAVLIVAQQLAVSWQSVTGGDTGILGI
FT                   PGLSFSAGGHTLDMSGPRASWYTVAIVLLAATGLIWLVCRSRYGKVLDAIAANEWRAKA
FT                   CGYHTSFHLLLVFVASAALAAIAGVLMAACSGVVAPDVFSPILATEVILWVAIGGRGRT
FT                   GGPVVAAVVLTLLRQTVSSYSTDGWPLILGGLFLACVLFLPNGLQLHELLEAARRAARA
FT                   VWSRPPVHRAEHAREER"
     MSGKHAGCLR LWLSQPALGP RDVSALLMWS VAMAAAALVP FFAGPWLLST VRDALVMGIL        60
     ALSYDLLWGR AGVLTLGHTT FLGLGAYGFA VATVQFGQAP VTGLVAGVLC AAAVAAVIGY       120
     FLLFAGVRLH FFAIISLAVL IVAQQLAVSW QSVTGGDTGI LGIPGLSFSA GGHTLDMSGP       180
     RASWYTVAIV LLAATGLIWL VCRSRYGKVL DAIAANEWRA KACGYHTSFH LLLVFVASAA       240
     LAAIAGVLMA ACSGVVAPDV FSPILATEVI LWVAIGGRGR TGGPVVAAVV LTLLRQTVSS       300
     YSTDGWPLIL GGLFLACVLF LPNGLQLHEL LEAARRAARA VWSRPPVHRA EHAREER          357
//

If you have problems or comments...

PBIL Back to PBIL home page