(data stored in ACNUC7421 zone)

EMBL: CP000272.PE41

CP000272.PE41        Location/Qualifiers
FT   CDS             complement(49331..50182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0042"
FT                   /product="H+-transporting two-sector ATPase, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35969"
FT                   /db_xref="GOA:Q13IX0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX0"
FT                   /protein_id="ABE35969.1"
FT                   /translation="MRGIAAARSREAQSRIEAIRACARTVGNAIGDALMFEQHDEPQAP
FT                   PGHAAGNEVVIVLCAEQGFVGTFNEHVIEATARRVASRSTEFFLIGARGIAVAAEHGLT
FT                   IGWSAPMVAHADEVPALADRITAALYERLNAGQATRVTLLHAVPNPSVTIEVVKTALWP
FT                   FDFTRFKQALRANPPLITLTPEILLAKLAEEYIFAQLCEAIMLSFAAENEARMRAMVAA
FT                   RTNVHDTLDELIGESRRLRQDEITSEIVELSSVTLAAATPRRRRHGERKRGKPEPGDSG
FT                   LS"
     MRGIAAARSR EAQSRIEAIR ACARTVGNAI GDALMFEQHD EPQAPPGHAA GNEVVIVLCA        60
     EQGFVGTFNE HVIEATARRV ASRSTEFFLI GARGIAVAAE HGLTIGWSAP MVAHADEVPA       120
     LADRITAALY ERLNAGQATR VTLLHAVPNP SVTIEVVKTA LWPFDFTRFK QALRANPPLI       180
     TLTPEILLAK LAEEYIFAQL CEAIMLSFAA ENEARMRAMV AARTNVHDTL DELIGESRRL       240
     RQDEITSEIV ELSSVTLAAA TPRRRRHGER KRGKPEPGDS GLS                         283
//

If you have problems or comments...

PBIL Back to PBIL home page