(data stored in ACNUC7421 zone)

EMBL: CP000272.PE410

CP000272.PE410       Location/Qualifiers
FT   CDS             457034..457777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0434"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36338"
FT                   /db_xref="GOA:Q13HV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HV1"
FT                   /protein_id="ABE36338.1"
FT                   /translation="MLRIENLCAGYGDVDVVHNVTLDVLPNEVVGVLGCNGAGKTTLVK
FT                   AVMGLLPRVSGQVSFLDQPVTGLRTHEIAQRGIGLVPQGRWIFPKLTVRENLLMGTQAA
FT                   GGADILDEVFDYFPVLKTRLSQQGGTLSGGEQQVLAISRALCGRPKLLLLDEPSDGVQP
FT                   NLVERIGEVIPELCRRSKLAVLLVEQNLDLVLQSARRCIVLSNGRLVHAGAVEPRHSGK
FT                   GEHPLARYLSPAADAAPDFRPENIQ"
     MLRIENLCAG YGDVDVVHNV TLDVLPNEVV GVLGCNGAGK TTLVKAVMGL LPRVSGQVSF        60
     LDQPVTGLRT HEIAQRGIGL VPQGRWIFPK LTVRENLLMG TQAAGGADIL DEVFDYFPVL       120
     KTRLSQQGGT LSGGEQQVLA ISRALCGRPK LLLLDEPSDG VQPNLVERIG EVIPELCRRS       180
     KLAVLLVEQN LDLVLQSARR CIVLSNGRLV HAGAVEPRHS GKGEHPLARY LSPAADAAPD       240
     FRPENIQ                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page