(data stored in ACNUC7421 zone)

EMBL: CP000272.PE413

CP000272.PE413       Location/Qualifiers
FT   CDS             460441..460986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0437"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36341"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU8"
FT                   /protein_id="ABE36341.1"
FT                   /translation="MNVQIARIVVHLVERCAELGTPVTPPHRQVVAAAVLKTTDQDVAW
FT                   ELEALYATGADLGQMLTGRALLALGCAGEDIQGYGKAALAGAGVPLEWGAALLHPRLGK
FT                   AVRDCLPGASSIMPSVTKRGPAGACIDIPMHSVTDMWSFDHFDTVSLCIPDSPAPDELL
FT                   VAVALAERGRPLARVRPG"
     MNVQIARIVV HLVERCAELG TPVTPPHRQV VAAAVLKTTD QDVAWELEAL YATGADLGQM        60
     LTGRALLALG CAGEDIQGYG KAALAGAGVP LEWGAALLHP RLGKAVRDCL PGASSIMPSV       120
     TKRGPAGACI DIPMHSVTDM WSFDHFDTVS LCIPDSPAPD ELLVAVALAE RGRPLARVRP       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page