(data stored in ACNUC7421 zone)

EMBL: CP000272.PE419

CP000272.PE419       Location/Qualifiers
FT   CDS             complement(464113..464391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0443"
FT                   /product="Putative nitrogen regulatory protein NtrP"
FT                   /function="involved in nitrogen regulation"
FT                   /note="Citation: Mol. Plant Microbe Interact. 14 (7),887-
FT                   894 (2001)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36347"
FT                   /db_xref="GOA:Q13HU2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU2"
FT                   /protein_id="ABE36347.1"
FT                   /translation="MIVPIPTPSARPREARLFRNNRSQAVRIPVEFELPGDRVLIHREG
FT                   DKLIIEPVRTPANIIELLAAWRQELPPGPDDQFPDIEDPPVRPEDVL"
     MIVPIPTPSA RPREARLFRN NRSQAVRIPV EFELPGDRVL IHREGDKLII EPVRTPANII        60
     ELLAAWRQEL PPGPDDQFPD IEDPPVRPED VL                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page