(data stored in ACNUC7421 zone)

EMBL: CP000272.PE420

CP000272.PE420       Location/Qualifiers
FT   CDS             464573..465262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36348"
FT                   /db_xref="GOA:Q13HU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HU1"
FT                   /protein_id="ABE36348.1"
FT                   /translation="MLSGNPVCARRLNSRPAQRAWDDYVRIFNAIFYRGRRMKSANDGP
FT                   VGIETDGGAGAGSSRKKISDWPRAVIASALGLIMAGIAYSLGDAYCNAYLAGFSVHSGA
FT                   FPADHPTHFVLAVWGGLHATLALQQWLGGHVLRLVCMTAVCLIYFAALPVIFAVISPII
FT                   ANGRGHVEGARALLGKRPLLRKYAGTVMAIMFFFLTALWFFLFVPRRYLFPPLSVRPLA
FT                   RMWRNWI"
     MLSGNPVCAR RLNSRPAQRA WDDYVRIFNA IFYRGRRMKS ANDGPVGIET DGGAGAGSSR        60
     KKISDWPRAV IASALGLIMA GIAYSLGDAY CNAYLAGFSV HSGAFPADHP THFVLAVWGG       120
     LHATLALQQW LGGHVLRLVC MTAVCLIYFA ALPVIFAVIS PIIANGRGHV EGARALLGKR       180
     PLLRKYAGTV MAIMFFFLTA LWFFLFVPRR YLFPPLSVRP LARMWRNWI                   229
//

If you have problems or comments...

PBIL Back to PBIL home page