(data stored in ACNUC7421 zone)

EMBL: CP000272.PE423

CP000272.PE423       Location/Qualifiers
FT   CDS             467543..468190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0447"
FT                   /product="Putative type IV secretion system protein VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36351"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT8"
FT                   /protein_id="ABE36351.1"
FT                   /translation="MIPLAAFLALTQQCAPAVAPATMAAIVRVESGFDPYAIGVVRGRL
FT                   ERQPANLDEAIATTRALEAGGWNYSAGLAQVNRANWVRLGLTPQAVFDPCRNLAAGAAI
FT                   LQGCFERARLRHPEAQNALRAGLSCYASGDFSSGFRTGYVQRVVAQAARPDPVVPAITT
FT                   DVPPIRVIPSSPQDARSGALRIPDGTPSTTDGRRNRPIGEPGDVTQESAVVF"
     MIPLAAFLAL TQQCAPAVAP ATMAAIVRVE SGFDPYAIGV VRGRLERQPA NLDEAIATTR        60
     ALEAGGWNYS AGLAQVNRAN WVRLGLTPQA VFDPCRNLAA GAAILQGCFE RARLRHPEAQ       120
     NALRAGLSCY ASGDFSSGFR TGYVQRVVAQ AARPDPVVPA ITTDVPPIRV IPSSPQDARS       180
     GALRIPDGTP STTDGRRNRP IGEPGDVTQE SAVVF                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page