(data stored in SCRATCH zone)

EMBL: CP000272.PE424

CP000272.PE424       Location/Qualifiers
FT   CDS             468226..468561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0448"
FT                   /product="Putative type IV secretion system protein
FT                   VirB2/TraC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36352"
FT                   /db_xref="GOA:Q13HT7"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT7"
FT                   /protein_id="ABE36352.1"
FT                   /translation="MKSGLQMKWKTIRLATRVLASVRAGRNGLAVAALLTVTPAYAQLS
FT                   QVNTLLTTIQTTLLSVGAVVCSISIIWAGFKMMFQHARFGDIANVFIGGLFVGCATVIA
FT                   AMLIPTS"
     MKSGLQMKWK TIRLATRVLA SVRAGRNGLA VAALLTVTPA YAQLSQVNTL LTTIQTTLLS        60
     VGAVVCSISI IWAGFKMMFQ HARFGDIANV FIGGLFVGCA TVIAAMLIPT S                111
//

If you have problems or comments...

PBIL Back to PBIL home page