(data stored in ACNUC7421 zone)

EMBL: CP000272.PE426

CP000272.PE426       Location/Qualifiers
FT   CDS             468909..471380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0450"
FT                   /product="Putative Type IV secretion system protein
FT                   VirB4/TraE"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36354"
FT                   /db_xref="GOA:Q13HT5"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT5"
FT                   /protein_id="ABE36354.1"
FT                   /translation="MSAQPQLIEVAEREVVLADFVPFSSHVTDHVIRTREGDYLSVWKI
FT                   AGIAFEAADPGDILVRHEGFNQLVRSLPGGHVGLWSHRIRRRVTDHFATPYGHPFCQEL
FT                   ATRYYASFAGYRMMANELYLTLVYRPRRTRLGRLFSQAARRTLDDIRRDQHEALKVMAE
FT                   LAAQVESGLKPWDPVALGVYRKQIRYTQRPVRFSAALEFLGYLVNAAWEPVPVPSGRIA
FT                   EALPTSRLFFRTEKVEIRMADATRYAALLDLKDYPEETEPGMLDGLLYGDFEYIETQSF
FT                   TILDRPTAKEALERQRNQMIAGEDVAVSQVQAMDQALDDLINGDFVLGEYHYSLAVLGD
FT                   RPDEVARHVAKARTQLADVGFQTALVDLVADAAWFAQLPGNWRYRPREAKLTSRNFCGL
FT                   ASLHNFATGKREGNPWGEAITIVKTPSGQPLYLNFHATPEKKESADEKALANTQIIGQA
FT                   GAGKTVLELFLLAMAMKYGLTGVVYDKDRGTEIAIRAMGGRYTVFRRGVPTGLNPFQLD
FT                   PDETVLDFWERLVRRLVDTGTLLSAKDELDISRAVREVARMERPLRRLSMVRQLLPAVG
FT                   ENSLHARLTKWCAGGRLGWVLDNPSDLLDFSQNRLFGFDDTELLDDPEVSTPVTMYLLQ
FT                   LTESLIDGRRFVYVMTEFWKRLGDPVFTDFAKDKQKTIRKQNGLGIFDTQSPADVLRSD
FT                   IARALVEQTATFFFLPNPRADYDDYVHGFKLTEAEFNIVRSLGENSRLFLVKQGHRSAI
FT                   GRLDLAGLGDVLDVLSGTTDNVELLDGIRAEVGDDPGVWLPVFHERLAKRRATGGALNA
FT                   LTPRLSGRGAR"
     MSAQPQLIEV AEREVVLADF VPFSSHVTDH VIRTREGDYL SVWKIAGIAF EAADPGDILV        60
     RHEGFNQLVR SLPGGHVGLW SHRIRRRVTD HFATPYGHPF CQELATRYYA SFAGYRMMAN       120
     ELYLTLVYRP RRTRLGRLFS QAARRTLDDI RRDQHEALKV MAELAAQVES GLKPWDPVAL       180
     GVYRKQIRYT QRPVRFSAAL EFLGYLVNAA WEPVPVPSGR IAEALPTSRL FFRTEKVEIR       240
     MADATRYAAL LDLKDYPEET EPGMLDGLLY GDFEYIETQS FTILDRPTAK EALERQRNQM       300
     IAGEDVAVSQ VQAMDQALDD LINGDFVLGE YHYSLAVLGD RPDEVARHVA KARTQLADVG       360
     FQTALVDLVA DAAWFAQLPG NWRYRPREAK LTSRNFCGLA SLHNFATGKR EGNPWGEAIT       420
     IVKTPSGQPL YLNFHATPEK KESADEKALA NTQIIGQAGA GKTVLELFLL AMAMKYGLTG       480
     VVYDKDRGTE IAIRAMGGRY TVFRRGVPTG LNPFQLDPDE TVLDFWERLV RRLVDTGTLL       540
     SAKDELDISR AVREVARMER PLRRLSMVRQ LLPAVGENSL HARLTKWCAG GRLGWVLDNP       600
     SDLLDFSQNR LFGFDDTELL DDPEVSTPVT MYLLQLTESL IDGRRFVYVM TEFWKRLGDP       660
     VFTDFAKDKQ KTIRKQNGLG IFDTQSPADV LRSDIARALV EQTATFFFLP NPRADYDDYV       720
     HGFKLTEAEF NIVRSLGENS RLFLVKQGHR SAIGRLDLAG LGDVLDVLSG TTDNVELLDG       780
     IRAEVGDDPG VWLPVFHERL AKRRATGGAL NALTPRLSGR GAR                         823
//

If you have problems or comments...

PBIL Back to PBIL home page