(data stored in ACNUC7421 zone)

EMBL: CP000272.PE427

CP000272.PE427       Location/Qualifiers
FT   CDS             471377..472534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0451"
FT                   /product="Putative type IV secretion system protein
FT                   VirB6/TraH"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36355"
FT                   /db_xref="GOA:Q13HT4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT4"
FT                   /protein_id="ABE36355.1"
FT                   /translation="MSGLFTAVGGTLENGMSTYVTSVSSALSSALVPVVTTALSIWIIT
FT                   YGFAVVRGEAHESVPAFAWRGLKVAVMLAFALGAGIYQSQVVTAVEGATTGLAQTIQTA
FT                   AANAGAGNPGCGTASGSSVTGTSASAIYQTLDCYDRQIDLVMDAYFNKATHEGFSVAGI
FT                   VAGIGDFACGLVAALGASVFLIVLAFEVVMARLLLDLVLGLGPLFIACGAFSPTARFFE
FT                   AWTAKIANYALLQVLIAAFLGMALTAFSADLAPFQVTSASPDANASTLTAAVQGALDNA
FT                   ASWGAGLGMCAAGVLLATVGWQLPAVASGLAGGATMSGFGAFVAGYAARQALRGVGAAM
FT                   RFGHGPRGPGGKISDGGAGSGSIPLYQRAAREHMGDQGNDGGSTS"
     MSGLFTAVGG TLENGMSTYV TSVSSALSSA LVPVVTTALS IWIITYGFAV VRGEAHESVP        60
     AFAWRGLKVA VMLAFALGAG IYQSQVVTAV EGATTGLAQT IQTAAANAGA GNPGCGTASG       120
     SSVTGTSASA IYQTLDCYDR QIDLVMDAYF NKATHEGFSV AGIVAGIGDF ACGLVAALGA       180
     SVFLIVLAFE VVMARLLLDL VLGLGPLFIA CGAFSPTARF FEAWTAKIAN YALLQVLIAA       240
     FLGMALTAFS ADLAPFQVTS ASPDANASTL TAAVQGALDN AASWGAGLGM CAAGVLLATV       300
     GWQLPAVASG LAGGATMSGF GAFVAGYAAR QALRGVGAAM RFGHGPRGPG GKISDGGAGS       360
     GSIPLYQRAA REHMGDQGND GGSTS                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page