(data stored in ACNUC7421 zone)

EMBL: CP000272.PE429

CP000272.PE429       Location/Qualifiers
FT   CDS             473442..474188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0453"
FT                   /product="Putative type IV secretion system protein
FT                   VirB8/TraJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36357"
FT                   /db_xref="GOA:Q13HT2"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HT2"
FT                   /protein_id="ABE36357.1"
FT                   /translation="MSSERDARESRDYRRALDFEVSVAHLQERSERRAWHVAMGSVVVA
FT                   ILCAVALAVMVPFYRVVPLPIEVDRLTGEAQVIDVLDAKQTHMRDIEDKHWVEAYVRSR
FT                   ERYDWGLLQMDYDRVLDMSDDRVARDYRSIYSGPDALDRQLGANTQRRIRILSTTLVPD
FT                   EPGRAVVHIERTTRKNGIDNAEPPQRFVVTLAFTYRPSVFTRERTAIENPFGFRVTAYS
FT                   RDPEYTPTAVSPASSPTLSPAPGGAP"
     MSSERDARES RDYRRALDFE VSVAHLQERS ERRAWHVAMG SVVVAILCAV ALAVMVPFYR        60
     VVPLPIEVDR LTGEAQVIDV LDAKQTHMRD IEDKHWVEAY VRSRERYDWG LLQMDYDRVL       120
     DMSDDRVARD YRSIYSGPDA LDRQLGANTQ RRIRILSTTL VPDEPGRAVV HIERTTRKNG       180
     IDNAEPPQRF VVTLAFTYRP SVFTRERTAI ENPFGFRVTA YSRDPEYTPT AVSPASSPTL       240
     SPAPGGAP                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page