(data stored in ACNUC7421 zone)

EMBL: CP000272.PE433

CP000272.PE433       Location/Qualifiers
FT   CDS             477373..477774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0457"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36361"
FT                   /db_xref="GOA:Q13HS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS8"
FT                   /protein_id="ABE36361.1"
FT                   /translation="MDIGKGTGTGRSASKAIRYHAMLVLVTLAVMAAAAAGLTLALWLA
FT                   SFFFAASQHVNPLHAGFHAWPDAALAWHDGRLPKEGRRLAGAALFGLLLAFGAPALGVY
FT                   TLLEQSGRRRLYGSARFANEADVRRAGLL"
     MDIGKGTGTG RSASKAIRYH AMLVLVTLAV MAAAAAGLTL ALWLASFFFA ASQHVNPLHA        60
     GFHAWPDAAL AWHDGRLPKE GRRLAGAALF GLLLAFGAPA LGVYTLLEQS GRRRLYGSAR       120
     FANEADVRRA GLL                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page