(data stored in ACNUC7421 zone)

EMBL: CP000272.PE434

CP000272.PE434       Location/Qualifiers
FT   CDS             477771..479552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0458"
FT                   /product="Putative type IV secretory pathway protein VirD4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36362"
FT                   /db_xref="GOA:Q13HS7"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS7"
FT                   /protein_id="ABE36362.1"
FT                   /translation="MSAATHSGGYGGPPLVVGVWRGRYLRFTGQQFVLLAAPARSGKGV
FT                   GIVVPNLLSYPDSVVVLDIKQENFNLTAGFRRAHGHDVYLFNPFAEDGRTHRYNPLSAI
FT                   SDGVFRVGDILAIGYALYPVGGHDDFWKDQARNLFLGIVLLLCEWRDACRTGNTDVPDY
FT                   PVTMGEVLRQSSGNGMPVKAYLQQALLQNRRLLSGACVDALNRFLANDDKVLASILATF
FT                   NAPLTIWANPIVDAATSANDFDLRDVRKRRMSVYVGITPDHLSEAALLVNLVFSQLVNL
FT                   NTRQLPQDSPELKVQCLLLMDEFTSVGKIHIIARAVAYMAGYNLRLLSIVQSVSQLESV
FT                   YGRADARTFVTNHAMQIIYAPREQKDANEYSEMLGTFTDRSRSVSRSNAVFGGRGGSSE
FT                   SFSEQRRPLLLPQELKELGREKEIILLENTKPILAERICYWRDPVFTSRLVAAPAIPAM
FT                   DLVRFIAQVERRVRDVQPDDVDEAGVMHIPPEYLEVLQAWDPRDLPRHLNDVTDEEAAA
FT                   YVERHFMLLGVPAARVAVAARRLSPSDLDVAELRPADRAPKRKSARSTGASRKQHGPAT
FT                   SRPTDGSNVVPLHGERR"
     MSAATHSGGY GGPPLVVGVW RGRYLRFTGQ QFVLLAAPAR SGKGVGIVVP NLLSYPDSVV        60
     VLDIKQENFN LTAGFRRAHG HDVYLFNPFA EDGRTHRYNP LSAISDGVFR VGDILAIGYA       120
     LYPVGGHDDF WKDQARNLFL GIVLLLCEWR DACRTGNTDV PDYPVTMGEV LRQSSGNGMP       180
     VKAYLQQALL QNRRLLSGAC VDALNRFLAN DDKVLASILA TFNAPLTIWA NPIVDAATSA       240
     NDFDLRDVRK RRMSVYVGIT PDHLSEAALL VNLVFSQLVN LNTRQLPQDS PELKVQCLLL       300
     MDEFTSVGKI HIIARAVAYM AGYNLRLLSI VQSVSQLESV YGRADARTFV TNHAMQIIYA       360
     PREQKDANEY SEMLGTFTDR SRSVSRSNAV FGGRGGSSES FSEQRRPLLL PQELKELGRE       420
     KEIILLENTK PILAERICYW RDPVFTSRLV AAPAIPAMDL VRFIAQVERR VRDVQPDDVD       480
     EAGVMHIPPE YLEVLQAWDP RDLPRHLNDV TDEEAAAYVE RHFMLLGVPA ARVAVAARRL       540
     SPSDLDVAEL RPADRAPKRK SARSTGASRK QHGPATSRPT DGSNVVPLHG ERR              593
//

If you have problems or comments...

PBIL Back to PBIL home page