(data stored in ACNUC7421 zone)

EMBL: CP000272.PE436

CP000272.PE436       Location/Qualifiers
FT   CDS             481529..483103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0460"
FT                   /product="Putative DNA primase, DNA transfer TraO-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36364"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS5"
FT                   /protein_id="ABE36364.1"
FT                   /translation="MMDETATSSGPRADEPVINVIEPDPPPLPDPQGGAAGAERFDRTA
FT                   ADVLAARRRREFDAVRARLRDQAIQADAPSQATAPQTPSQQTSQQATPHGADDVSATRW
FT                   APLGDPPETVRKRYLRAGNQYFLKDAPHQLAFEDIGPYLVTEHNRPDVVESMVDMARAK
FT                   AWGRIRVSGHEQFRREVWVQATLLGIEVSGYEPKAVDLARLADGRRDRMTNRIDVMEPS
FT                   AAAQAPANRQEAPKAARGSAESQATQPARRDASRAPEARGSAPPAPAEPPRTAPVAETV
FT                   PRVAESEGQERQRYMGELVEHGGAPYQHNPARSDSYYVVYRDTGGADHVVWGVDLERAV
FT                   ADSGALAGQQVMLENLGRRLVTVTVPVLDATGNVIGEEEKEVYRNTWQVDVAGQERAQS
FT                   RPGATERQGDAGRSETAAPEAPEQAQAARRRESSVVPGEERAVQMAVLSAAMRQQGFSE
FT                   RSIARVQQHAQRLMAAFVAEGVSVPRPRVFDPEAPSARSRRARTAAERAPGREVERGPA
FT                   EPAPPSL"
     MMDETATSSG PRADEPVINV IEPDPPPLPD PQGGAAGAER FDRTAADVLA ARRRREFDAV        60
     RARLRDQAIQ ADAPSQATAP QTPSQQTSQQ ATPHGADDVS ATRWAPLGDP PETVRKRYLR       120
     AGNQYFLKDA PHQLAFEDIG PYLVTEHNRP DVVESMVDMA RAKAWGRIRV SGHEQFRREV       180
     WVQATLLGIE VSGYEPKAVD LARLADGRRD RMTNRIDVME PSAAAQAPAN RQEAPKAARG       240
     SAESQATQPA RRDASRAPEA RGSAPPAPAE PPRTAPVAET VPRVAESEGQ ERQRYMGELV       300
     EHGGAPYQHN PARSDSYYVV YRDTGGADHV VWGVDLERAV ADSGALAGQQ VMLENLGRRL       360
     VTVTVPVLDA TGNVIGEEEK EVYRNTWQVD VAGQERAQSR PGATERQGDA GRSETAAPEA       420
     PEQAQAARRR ESSVVPGEER AVQMAVLSAA MRQQGFSERS IARVQQHAQR LMAAFVAEGV       480
     SVPRPRVFDP EAPSARSRRA RTAAERAPGR EVERGPAEPA PPSL                        524
//

If you have problems or comments...

PBIL Back to PBIL home page