(data stored in ACNUC7421 zone)

EMBL: CP000272.PE437

CP000272.PE437       Location/Qualifiers
FT   CDS             483114..483635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0461"
FT                   /product="Plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36365"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS4"
FT                   /protein_id="ABE36365.1"
FT                   /translation="MASRARLCVDLGPAKSRWEAWCALHGLTAADGVRQLVHGVLSRDE
FT                   SSEGVTERERHRLLVEGHRERVEIRLTQEELEAASQRALASGLNVNRWMVAVIRAQLVH
FT                   EPQLGEREMRLLADSNQHLAVIVTVLGRLQAHGGASDAGCVLKDTRAVIDTHLRTVTQV
FT                   LRANLDRWSR"
     MASRARLCVD LGPAKSRWEA WCALHGLTAA DGVRQLVHGV LSRDESSEGV TERERHRLLV        60
     EGHRERVEIR LTQEELEAAS QRALASGLNV NRWMVAVIRA QLVHEPQLGE REMRLLADSN       120
     QHLAVIVTVL GRLQAHGGAS DAGCVLKDTR AVIDTHLRTV TQVLRANLDR WSR              173
//

If you have problems or comments...

PBIL Back to PBIL home page