(data stored in SCRATCH zone)

EMBL: CP000272.PE44

CP000272.PE44        Location/Qualifiers
FT   CDS             complement(52584..52832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0045"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35972"
FT                   /db_xref="GOA:Q13IW7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW7"
FT                   /protein_id="ABE35972.1"
FT                   /translation="MTNLIQVISILAAAIAVSFGAIGPALGEGRAVAAAMDALARQPES
FT                   AGTISRTLFVGLAMIETMAIYCLVIALLVLFANPFVK"
     MTNLIQVISI LAAAIAVSFG AIGPALGEGR AVAAAMDALA RQPESAGTIS RTLFVGLAMI        60
     ETMAIYCLVI ALLVLFANPF VK                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page