(data stored in ACNUC7421 zone)

EMBL: CP000272.PE440

CP000272.PE440       Location/Qualifiers
FT   CDS             complement(485571..485999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36368"
FT                   /db_xref="GOA:Q13HS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HS1"
FT                   /protein_id="ABE36368.1"
FT                   /translation="MGVLKLALIIAVVVGVAKGIQLFNRHCRRRFGHSFFTTRGFWLAA
FT                   IAINLLWWGFYFWGTAFVHHTTTSDGIILMVLGIVAIAWLLYENIRETDIVHGIGGSTL
FT                   QLVLFLPLALYSFPLLIMGMVFVLVASYKAGPALFIER"
     MGVLKLALII AVVVGVAKGI QLFNRHCRRR FGHSFFTTRG FWLAAIAINL LWWGFYFWGT        60
     AFVHHTTTSD GIILMVLGIV AIAWLLYENI RETDIVHGIG GSTLQLVLFL PLALYSFPLL       120
     IMGMVFVLVA SYKAGPALFI ER                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page