(data stored in ACNUC7421 zone)

EMBL: CP000272.PE444

CP000272.PE444       Location/Qualifiers
FT   CDS             487906..488340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0468"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36372"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR7"
FT                   /protein_id="ABE36372.1"
FT                   /translation="MGWPLRPATQLPEMEMNEAPPHLTCSSASAPPGHCGEPSLNRIAI
FT                   HLALLPGQTVSWRIVADSEISAHGSRVWLTRSFSPYDYWMQPGDVLRVTRGERIWLSSE
FT                   GGGTTEVTVTSEHAGRLASTGGWLCRLREIVFDLSFPRAR"
     MGWPLRPATQ LPEMEMNEAP PHLTCSSASA PPGHCGEPSL NRIAIHLALL PGQTVSWRIV        60
     ADSEISAHGS RVWLTRSFSP YDYWMQPGDV LRVTRGERIW LSSEGGGTTE VTVTSEHAGR       120
     LASTGGWLCR LREIVFDLSF PRAR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page