(data stored in ACNUC7421 zone)

EMBL: CP000272.PE445

CP000272.PE445       Location/Qualifiers
FT   CDS             488436..488870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36373"
FT                   /db_xref="GOA:Q13HR6"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR6"
FT                   /protein_id="ABE36373.1"
FT                   /translation="MNNCKPEFHETGKISQGDDNLQHCIAGVCLTLLLITLFVIAGVCM
FT                   RQEPRGVDGECLQRVTNGEHASLEAFFQNPVQRDAMAQAINACSGRGAAAMWAHETTGL
FT                   GRVRISAHRLGSRKALPTTAHANPAEGTRICTTVRMTRLS"
     MNNCKPEFHE TGKISQGDDN LQHCIAGVCL TLLLITLFVI AGVCMRQEPR GVDGECLQRV        60
     TNGEHASLEA FFQNPVQRDA MAQAINACSG RGAAAMWAHE TTGLGRVRIS AHRLGSRKAL       120
     PTTAHANPAE GTRICTTVRM TRLS                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page