(data stored in ACNUC7421 zone)

EMBL: CP000272.PE451

CP000272.PE451       Location/Qualifiers
FT   CDS             492943..493665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36379"
FT                   /db_xref="GOA:Q13HR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HR0"
FT                   /protein_id="ABE36379.1"
FT                   /translation="MRERRSRRTRPADPLARLFLEVSGAPPDDASLLRMRRVSAALNLR
FT                   DNDALWSVLAVLEYYVRLYEAMPERIRQAGAGGVDAARAEAYAATQALMVQHREALARC
FT                   KETITLAERMTAEHEARYRAALAALSDEALSALTQHAADRIARVAGNRIVGAAAVAARE
FT                   QRQRLDAALASFERVAMRRLVRACYGLVAGGLVVVLLAAGAGCVAGWWAGIHWTQADGS
FT                   PPVRTGDTSPVPRPTMRQ"
     MRERRSRRTR PADPLARLFL EVSGAPPDDA SLLRMRRVSA ALNLRDNDAL WSVLAVLEYY        60
     VRLYEAMPER IRQAGAGGVD AARAEAYAAT QALMVQHREA LARCKETITL AERMTAEHEA       120
     RYRAALAALS DEALSALTQH AADRIARVAG NRIVGAAAVA AREQRQRLDA ALASFERVAM       180
     RRLVRACYGL VAGGLVVVLL AAGAGCVAGW WAGIHWTQAD GSPPVRTGDT SPVPRPTMRQ       240
//

If you have problems or comments...

PBIL Back to PBIL home page