(data stored in SCRATCH zone)

EMBL: CP000272.PE455

CP000272.PE455       Location/Qualifiers
FT   CDS             498310..498573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36383"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HQ6"
FT                   /protein_id="ABE36383.1"
FT                   /translation="MGETACHAQPEAGAGLIVRGRSTRFASRVSPSGETAVPRITVAVP
FT                   VTGANGVTAWDESGDRAMAIAADERIPGGTAAGSSQGACLLQ"
     MGETACHAQP EAGAGLIVRG RSTRFASRVS PSGETAVPRI TVAVPVTGAN GVTAWDESGD        60
     RAMAIAADER IPGGTAAGSS QGACLLQ                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page