(data stored in ACNUC7421 zone)

EMBL: CP000272.PE46

CP000272.PE46        Location/Qualifiers
FT   CDS             complement(53801..54112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0047"
FT                   /product="Putative ATP synthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35974"
FT                   /db_xref="GOA:Q13IW5"
FT                   /db_xref="InterPro:IPR011744"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW5"
FT                   /protein_id="ABE35974.1"
FT                   /translation="MSRSDEPDDNERLAHAARQARTRERRARDEPEPSLGNRLGQIGIL
FT                   GWSIVIPTLLGLAIGHWLDRHFGTGVFFSAPLLMIGAAFGLWSAWKWMHRQTRSKHHD"
     MSRSDEPDDN ERLAHAARQA RTRERRARDE PEPSLGNRLG QIGILGWSIV IPTLLGLAIG        60
     HWLDRHFGTG VFFSAPLLMI GAAFGLWSAW KWMHRQTRSK HHD                         103
//

If you have problems or comments...

PBIL Back to PBIL home page