(data stored in ACNUC7421 zone)

EMBL: CP000272.PE462

CP000272.PE462       Location/Qualifiers
FT   CDS             complement(503776..504471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0486"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP9"
FT                   /protein_id="ABE36390.1"
FT                   /translation="MRTTIIYAALVVVLSLLMATGCTSGDSGSRLQGVSTTTIAEPCCG
FT                   PISPAAQTILGMLDNSNVEHLWPNHRHINWETGEPDEPEGYAGPGKHTHCSAFAAAIGE
FT                   RLNVYMLRPPEHSQILLASAQTHWFNSPEGRGAGWFAIADLRQAQSLANQGKLVVVAYE
FT                   SPNLKTPGHIAIVRPSAISSDALRDRGPEVTQAGAENYLRIDARTAFAYHPGAWPEGVR
FT                   YFGHDVPRR"
     MRTTIIYAAL VVVLSLLMAT GCTSGDSGSR LQGVSTTTIA EPCCGPISPA AQTILGMLDN        60
     SNVEHLWPNH RHINWETGEP DEPEGYAGPG KHTHCSAFAA AIGERLNVYM LRPPEHSQIL       120
     LASAQTHWFN SPEGRGAGWF AIADLRQAQS LANQGKLVVV AYESPNLKTP GHIAIVRPSA       180
     ISSDALRDRG PEVTQAGAEN YLRIDARTAF AYHPGAWPEG VRYFGHDVPR R                231
//

If you have problems or comments...

PBIL Back to PBIL home page