(data stored in ACNUC7421 zone)

EMBL: CP000272.PE463

CP000272.PE463       Location/Qualifiers
FT   CDS             complement(504637..504885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36391"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP8"
FT                   /protein_id="ABE36391.1"
FT                   /translation="MMPTRGFRRSLGTGKSLSFSNSKSNFNQVAVVTDYFFSKTTHLFF
FT                   MAGWQRAGGATHQAQLSGTASSNNHQILLTAGIGKKF"
     MMPTRGFRRS LGTGKSLSFS NSKSNFNQVA VVTDYFFSKT THLFFMAGWQ RAGGATHQAQ        60
     LSGTASSNNH QILLTAGIGK KF                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page