(data stored in ACNUC7421 zone)

EMBL: CP000272.PE468

CP000272.PE468       Location/Qualifiers
FT   CDS             509759..510181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36396"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP3"
FT                   /protein_id="ABE36396.1"
FT                   /translation="MTASSREARFPVSRVGPYRRMLKESSETKVVADIRSEHLFPVTDG
FT                   DTARDSAGGWVQGRIELVEPPGSLVMVQVMVGYSVIVAQFERPPGFDVGRAIILQHKIY
FT                   APHAFDVGTERSVLAAPLRVPCGVWQCMSERFEPYS"
     MTASSREARF PVSRVGPYRR MLKESSETKV VADIRSEHLF PVTDGDTARD SAGGWVQGRI        60
     ELVEPPGSLV MVQVMVGYSV IVAQFERPPG FDVGRAIILQ HKIYAPHAFD VGTERSVLAA       120
     PLRVPCGVWQ CMSERFEPYS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page