(data stored in ACNUC7421 zone)

EMBL: CP000272.PE47

CP000272.PE47        Location/Qualifiers
FT   CDS             complement(54109..54528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0048"
FT                   /product="H+-transporting two-sector ATPase, delta/epsilon
FT                   subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35975"
FT                   /db_xref="GOA:Q13IW4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR024037"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13IW4"
FT                   /protein_id="ABE35975.1"
FT                   /translation="MSPTLRLTISTPASLLVNAQAIVALRAEDGSGSFGILPGHADFLT
FT                   VLTPCVLRWRGTENIRRFCAVEEGVLRVSEGHSVTIACRSGMLGDSLAALEAQIETARA
FT                   RTLDTARNARVEQTRLHAQAVRQLLRYLRPSRGDA"
     MSPTLRLTIS TPASLLVNAQ AIVALRAEDG SGSFGILPGH ADFLTVLTPC VLRWRGTENI        60
     RRFCAVEEGV LRVSEGHSVT IACRSGMLGD SLAALEAQIE TARARTLDTA RNARVEQTRL       120
     HAQAVRQLLR YLRPSRGDA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page