(data stored in ACNUC7421 zone)

EMBL: CP000272.PE471

CP000272.PE471       Location/Qualifiers
FT   CDS             513681..514931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0498"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36399"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HP0"
FT                   /protein_id="ABE36399.1"
FT                   /translation="MLAELILVTKMAFLRRLFDCRISRHVLSLGVLILGIGTLLALPVM
FT                   AVEPFKIVGIVALSGTYGIYGDDMRKGLDLAVAQRKTVLGRPIQVVWEDTQSKADVASQ
FT                   KAIKAASSGADLIFGSVASSETLALEQISESRKIPLLITQSSADAITAKPHRYVFRTRE
FT                   KFSNEVLMVQHYIEKNKSASVYAVVADASVFRDGWTEIQHGLVADGVALKGDDVVPFGA
FT                   TDYSVVVGKAAASGANTLVLFLAGSDAVTFIKQAAAVRLMDHMRVVGPTIMDDSMAKAA
FT                   GDAALGVVSAVGYHHSIDNDANRKFVSEYRKSYSGIAPSFGAGEAYEGINWMLDVIERT
FT                   HSSDPAVWISAMEKSADPNSIEGAKRMRWCDHQADRVSYMVEGVKGSGAQPELKIIGAW
FT                   TDGELGQKPCPVGQGRP"
     MLAELILVTK MAFLRRLFDC RISRHVLSLG VLILGIGTLL ALPVMAVEPF KIVGIVALSG        60
     TYGIYGDDMR KGLDLAVAQR KTVLGRPIQV VWEDTQSKAD VASQKAIKAA SSGADLIFGS       120
     VASSETLALE QISESRKIPL LITQSSADAI TAKPHRYVFR TREKFSNEVL MVQHYIEKNK       180
     SASVYAVVAD ASVFRDGWTE IQHGLVADGV ALKGDDVVPF GATDYSVVVG KAAASGANTL       240
     VLFLAGSDAV TFIKQAAAVR LMDHMRVVGP TIMDDSMAKA AGDAALGVVS AVGYHHSIDN       300
     DANRKFVSEY RKSYSGIAPS FGAGEAYEGI NWMLDVIERT HSSDPAVWIS AMEKSADPNS       360
     IEGAKRMRWC DHQADRVSYM VEGVKGSGAQ PELKIIGAWT DGELGQKPCP VGQGRP           416
//

If you have problems or comments...

PBIL Back to PBIL home page