(data stored in SCRATCH zone)

EMBL: CP000272.PE472

CP000272.PE472       Location/Qualifiers
FT   CDS             514928..515788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0499"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36400"
FT                   /db_xref="GOA:Q13HN9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN9"
FT                   /protein_id="ABE36400.1"
FT                   /translation="MSTIVIGLSIGMLLFLLASGLTVIFGTLGVVNFAHGAMYSFGAYL
FT                   TWQAISWTNSFWLGLAFAPLVMAAVGFVFEILCLRKTYSRDHVLQLLVTFGLVLILEEV
FT                   AKVIWGLDYKNVSTPGILAGTWSVAGTEVAIYRLFVIAFGSVISFALFAVIDHSRAGMI
FT                   LRAAETHAPMVRCMGIKVDWVRTAVFAVGSGLAALGGAIASPLLPVQPGAGFTIIIDSF
FT                   LVVLIGGLGNIRGAIFSALAIGMGRALGQRWLPDWVDILTYAILVGVLMLSPQGLFSRG
FT                   PGRKG"
     MSTIVIGLSI GMLLFLLASG LTVIFGTLGV VNFAHGAMYS FGAYLTWQAI SWTNSFWLGL        60
     AFAPLVMAAV GFVFEILCLR KTYSRDHVLQ LLVTFGLVLI LEEVAKVIWG LDYKNVSTPG       120
     ILAGTWSVAG TEVAIYRLFV IAFGSVISFA LFAVIDHSRA GMILRAAETH APMVRCMGIK       180
     VDWVRTAVFA VGSGLAALGG AIASPLLPVQ PGAGFTIIID SFLVVLIGGL GNIRGAIFSA       240
     LAIGMGRALG QRWLPDWVDI LTYAILVGVL MLSPQGLFSR GPGRKG                      286
//

If you have problems or comments...

PBIL Back to PBIL home page