(data stored in SCRATCH zone)

EMBL: CP000272.PE474

CP000272.PE474       Location/Qualifiers
FT   CDS             516726..517520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0501"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36402"
FT                   /db_xref="GOA:Q13HN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN7"
FT                   /protein_id="ABE36402.1"
FT                   /translation="MNASPVSHIAGSIEPSPVLLCENISVDFAGFQALREVTVSVRSGQ
FT                   TIALIGPNGAGKSTLMNVMSGLLSPTAGSIRLHDRDVTSSSPSKLARLGVARSFQNISL
FT                   FASMTVYENLRLAVQRQLFDIAPFWKPVAGYRRLNEATDLALERSHLTTHRNRLAAELS
FT                   HGQQRALDLGMTLIGDPKILLLDEPLAGVGHDDLDFFLTLLRKVCSNRTVLLVEHNMDA
FT                   VMGLADEVVVLVGGQVLTKGSPAEIRANPKVRESYLGSGEES"
     MNASPVSHIA GSIEPSPVLL CENISVDFAG FQALREVTVS VRSGQTIALI GPNGAGKSTL        60
     MNVMSGLLSP TAGSIRLHDR DVTSSSPSKL ARLGVARSFQ NISLFASMTV YENLRLAVQR       120
     QLFDIAPFWK PVAGYRRLNE ATDLALERSH LTTHRNRLAA ELSHGQQRAL DLGMTLIGDP       180
     KILLLDEPLA GVGHDDLDFF LTLLRKVCSN RTVLLVEHNM DAVMGLADEV VVLVGGQVLT       240
     KGSPAEIRAN PKVRESYLGS GEES                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page