(data stored in ACNUC7421 zone)

EMBL: CP000272.PE478

CP000272.PE478       Location/Qualifiers
FT   CDS             520895..521296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0505"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36406"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:2O8Q"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN3"
FT                   /protein_id="ABE36406.1"
FT                   /translation="MKLQTTIQHEPKDGSGFDRGLREFFEYRDTGVNEATGGMFGAHVI
FT                   RAIPGKEAKPTWHTHTVGFQLFYVLRGWVEFEYEDIGAVMLEAGGSAFQPPGVRHRELR
FT                   HSDDLEVLEIVSPAGFATSVVDLEEARKP"
     MKLQTTIQHE PKDGSGFDRG LREFFEYRDT GVNEATGGMF GAHVIRAIPG KEAKPTWHTH        60
     TVGFQLFYVL RGWVEFEYED IGAVMLEAGG SAFQPPGVRH RELRHSDDLE VLEIVSPAGF       120
     ATSVVDLEEA RKP                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page