(data stored in ACNUC7421 zone)

EMBL: CP000272.PE479

CP000272.PE479       Location/Qualifiers
FT   CDS             521293..521673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36407"
FT                   /db_xref="GOA:Q13HN2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HN2"
FT                   /protein_id="ABE36407.1"
FT                   /translation="MTMMYDWNRLPREVVRPGVERCGFRGDDSILVMNWISPAIDVRPH
FT                   QHEFEQLVVCVQGSFNYHVGDRVFHMAPGCMLRVPPRTVHYIEPVGHEVALNLDIFAPM
FT                   RDDYRHLVEYQAGEFPGNRGNA"
     MTMMYDWNRL PREVVRPGVE RCGFRGDDSI LVMNWISPAI DVRPHQHEFE QLVVCVQGSF        60
     NYHVGDRVFH MAPGCMLRVP PRTVHYIEPV GHEVALNLDI FAPMRDDYRH LVEYQAGEFP       120
     GNRGNA                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page