(data stored in ACNUC7421 zone)

EMBL: CP000272.PE48

CP000272.PE48        Location/Qualifiers
FT   CDS             complement(54525..56006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0049"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35976"
FT                   /db_xref="GOA:Q13IW3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13IW3"
FT                   /protein_id="ABE35976.1"
FT                   /translation="MDTAQPAMTAPPAQAAADEPVGRVTAVRGAVIDVAFDTGALPMIE
FT                   DALVITTDDGQPIIAEVQAHLDEGTVRALALRSTNGLRRGAPVRAAGGPIEVPVGEAML
FT                   GRLIDVSGVPGDNGTPLPPGTPRRPIHRKPPPLASQGAETRIFATGIKVIDLLTPLAQG
FT                   GKAAMFGGAGVGKTVLVMELIHAMVERYQGISVFAGVGERCREGHEMLTDMRHSGVLPR
FT                   TVLVYGQMNEPPGARWRVPLTALTVAEYFRDERHQNVLLLMDNVFRFVQAGAEVSGLLG
FT                   RLPSRVGYQPTLATEVAGLQERIVSVGDVSVTAIEAVYVPADDFTDPAVTAIAAHVDSM
FT                   VVLSRSMAAEGMYPAIDPIASSSVLLDPLVVGGEHARIAIEVRRAVEHYRELQDVISLL
FT                   GVEELGADDRRIVGRARRLQRFLTQPFAVTEAFTGVPGRSVPVADTLAGCKAILDGNCD
FT                   DWQESSLYMVGTLDEAREREQATRNAKPVSEHAEP"
     MDTAQPAMTA PPAQAAADEP VGRVTAVRGA VIDVAFDTGA LPMIEDALVI TTDDGQPIIA        60
     EVQAHLDEGT VRALALRSTN GLRRGAPVRA AGGPIEVPVG EAMLGRLIDV SGVPGDNGTP       120
     LPPGTPRRPI HRKPPPLASQ GAETRIFATG IKVIDLLTPL AQGGKAAMFG GAGVGKTVLV       180
     MELIHAMVER YQGISVFAGV GERCREGHEM LTDMRHSGVL PRTVLVYGQM NEPPGARWRV       240
     PLTALTVAEY FRDERHQNVL LLMDNVFRFV QAGAEVSGLL GRLPSRVGYQ PTLATEVAGL       300
     QERIVSVGDV SVTAIEAVYV PADDFTDPAV TAIAAHVDSM VVLSRSMAAE GMYPAIDPIA       360
     SSSVLLDPLV VGGEHARIAI EVRRAVEHYR ELQDVISLLG VEELGADDRR IVGRARRLQR       420
     FLTQPFAVTE AFTGVPGRSV PVADTLAGCK AILDGNCDDW QESSLYMVGT LDEAREREQA       480
     TRNAKPVSEH AEP                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page