(data stored in ACNUC7421 zone)

EMBL: CP000272.PE482

CP000272.PE482       Location/Qualifiers
FT   CDS             524119..524673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36410"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM9"
FT                   /protein_id="ABE36410.1"
FT                   /translation="MISTQREIVVQQPPAQAWIFVREIGNWAAQMPGYLKHEEKGPDDS
FT                   VWTLDIHLGPFSRPVELSVHVVRWLPGEGADFRLKATYEPFHGEGSFRLTAVPGGTNMV
FT                   MILGTEVTGSMSKLLTAMAAPVLEKVADEFSRNLVAVLGGAPELASPSDRPAQNDTRTS
FT                   IVSAFRGWLVGIHRRLTRAKT"
     MISTQREIVV QQPPAQAWIF VREIGNWAAQ MPGYLKHEEK GPDDSVWTLD IHLGPFSRPV        60
     ELSVHVVRWL PGEGADFRLK ATYEPFHGEG SFRLTAVPGG TNMVMILGTE VTGSMSKLLT       120
     AMAAPVLEKV ADEFSRNLVA VLGGAPELAS PSDRPAQNDT RTSIVSAFRG WLVGIHRRLT       180
     RAKT                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page