(data stored in ACNUC7421 zone)

EMBL: CP000272.PE485

CP000272.PE485       Location/Qualifiers
FT   CDS             526388..527368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36413"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM6"
FT                   /protein_id="ABE36413.1"
FT                   /translation="MGADYASAVSYTRTGSGDDLPDWVGREFVIHAPFPVESSRIADFC
FT                   AMLEDPNPLYWDIEAATQKFGRPIAPPATLTAWRWPAPWNPYGRPEHGFPATVEVPCPT
FT                   DTLVNVEFACEYLQQIGVGDKLTYVDRIAAISDEKMTALGRGYFVTADTVVTNQENQEV
FT                   ARYRNVMLRYKSGTGKAADSQKVQQPAPEKVPTDSERPIPALSIPVTWTLCTQLTAATR
FT                   DYFPGHHDPDYARSQGVLNPYPNTGYYCGLMDRVALEWANFDGVLKRRVLRMFTPAPIG
FT                   TTLRTSGRVLSRQTVEGTEHVELQIEVRNEEALIAQARITLKMGA"
     MGADYASAVS YTRTGSGDDL PDWVGREFVI HAPFPVESSR IADFCAMLED PNPLYWDIEA        60
     ATQKFGRPIA PPATLTAWRW PAPWNPYGRP EHGFPATVEV PCPTDTLVNV EFACEYLQQI       120
     GVGDKLTYVD RIAAISDEKM TALGRGYFVT ADTVVTNQEN QEVARYRNVM LRYKSGTGKA       180
     ADSQKVQQPA PEKVPTDSER PIPALSIPVT WTLCTQLTAA TRDYFPGHHD PDYARSQGVL       240
     NPYPNTGYYC GLMDRVALEW ANFDGVLKRR VLRMFTPAPI GTTLRTSGRV LSRQTVEGTE       300
     HVELQIEVRN EEALIAQARI TLKMGA                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page