(data stored in ACNUC7421 zone)

EMBL: CP000272.PE49

CP000272.PE49        Location/Qualifiers
FT   CDS             complement(56010..56783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0050"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35977"
FT                   /db_xref="GOA:Q13IW2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IW2"
FT                   /protein_id="ABE35977.1"
FT                   /translation="MNGIIDLSGKRGLVVGIANEHSIAAGCARMFRAIGAEIAVTYLND
FT                   KAEPYVRAVAETLPASLVMPCDVTVPGQLEAVFARISREWGKLDFVLHSIAFAPAVDLH
FT                   ASLVDCSAEGFALAMDVSCHSFIRMTRLALPLMAEGGSLMTVSFYGAERAVDHYNLMGP
FT                   VKAALESSVRYLAVDLAPRRVHVHAISAGAVKTRAASGLDHFDVLLDEVRARTPARHLV
FT                   TIDEIGRIAAVLASDAGMTLTGSTLYADAGFHVVA"
     MNGIIDLSGK RGLVVGIANE HSIAAGCARM FRAIGAEIAV TYLNDKAEPY VRAVAETLPA        60
     SLVMPCDVTV PGQLEAVFAR ISREWGKLDF VLHSIAFAPA VDLHASLVDC SAEGFALAMD       120
     VSCHSFIRMT RLALPLMAEG GSLMTVSFYG AERAVDHYNL MGPVKAALES SVRYLAVDLA       180
     PRRVHVHAIS AGAVKTRAAS GLDHFDVLLD EVRARTPARH LVTIDEIGRI AAVLASDAGM       240
     TLTGSTLYAD AGFHVVA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page