(data stored in ACNUC7421 zone)

EMBL: CP000272.PE490

CP000272.PE490       Location/Qualifiers
FT   CDS             532507..533040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36418"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM1"
FT                   /protein_id="ABE36418.1"
FT                   /translation="MNQEDDAKLAYLMAVNAIQMTKARYCRFVDTKQWDRLRTLFTADC
FT                   RFEGLGSAPDRADLDIFIQGISRRLAHVVSVHHCHMGEIELVGADEAKVIWAMEDHLEW
FT                   QDSGEVVEAPGNRGFRGYGHYEECYVRQGDTWKISLLRLTRLGIHPIPDAQPRLGTGRL
FT                   GANPDWLPSDRRLR"
     MNQEDDAKLA YLMAVNAIQM TKARYCRFVD TKQWDRLRTL FTADCRFEGL GSAPDRADLD        60
     IFIQGISRRL AHVVSVHHCH MGEIELVGAD EAKVIWAMED HLEWQDSGEV VEAPGNRGFR       120
     GYGHYEECYV RQGDTWKISL LRLTRLGIHP IPDAQPRLGT GRLGANPDWL PSDRRLR          177
//

If you have problems or comments...

PBIL Back to PBIL home page