(data stored in SCRATCH zone)

EMBL: CP000272.PE491

CP000272.PE491       Location/Qualifiers
FT   CDS             533037..533594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0518"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36419"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HM0"
FT                   /protein_id="ABE36419.1"
FT                   /translation="MTAERKHLHSRCITCEAYLCEDGSVELEGMLTDTKSHPFNVGDQG
FT                   VLPTGHPVHQMLVRLRVASDFRITEAEARTIHGPYRVCGDIAPQYSKLVGLTIGPGFNA
FT                   LVKRMFRERLGCTHLTELLPVIATVAYQAIWSEFRSFEKFDPANAAERRSTPLGGCHAL
FT                   QPDGEVVRLHFPDRYKPPDPSA"
     MTAERKHLHS RCITCEAYLC EDGSVELEGM LTDTKSHPFN VGDQGVLPTG HPVHQMLVRL        60
     RVASDFRITE AEARTIHGPY RVCGDIAPQY SKLVGLTIGP GFNALVKRMF RERLGCTHLT       120
     ELLPVIATVA YQAIWSEFRS FEKFDPANAA ERRSTPLGGC HALQPDGEVV RLHFPDRYKP       180
     PDPSA                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page