(data stored in ACNUC7421 zone)

EMBL: CP000272.PE494

CP000272.PE494       Location/Qualifiers
FT   CDS             complement(539348..539644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36422"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL7"
FT                   /protein_id="ABE36422.1"
FT                   /translation="MNERKKLDLRVAAQGLDEAGAEDVSRDIALSQDGNRYGAVLSVNL
FT                   RQDIRRRLRFTTGIVAAMRSQQHSCAVAFRIAGNVSRRQSVAIAPSPEEQSAR"
     MNERKKLDLR VAAQGLDEAG AEDVSRDIAL SQDGNRYGAV LSVNLRQDIR RRLRFTTGIV        60
     AAMRSQQHSC AVAFRIAGNV SRRQSVAIAP SPEEQSAR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page