(data stored in SCRATCH zone)

EMBL: CP000272.PE5

CP000272.PE5         Location/Qualifiers
FT   CDS             6440..7225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0005"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35933"
FT                   /db_xref="GOA:Q13J06"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J06"
FT                   /protein_id="ABE35933.1"
FT                   /translation="MQSAVNLYPLFGVVVIVAGFLLRFNPMLIVTVAAIITGLAAHFPV
FT                   DRILIAIGSGFVKTRVIPLIILFPLAVIGLLERHGLRERAQTWIGGIRAATPGRLLIAY
FT                   LFVREITAALGLTGLGGHPQMVRPLVAPMAEGAALARFGKLRDPARFRLRAFAAATDNV
FT                   GLFFGEDIFVAFGAIVLMVTFLKETGIVVEPMRVALWGMPTALAAFLVHSFRLYRLDGW
FT                   LGRHAAADEDAASANEPSVDAPGNPRRDGVVGAGQGEQA"
     MQSAVNLYPL FGVVVIVAGF LLRFNPMLIV TVAAIITGLA AHFPVDRILI AIGSGFVKTR        60
     VIPLIILFPL AVIGLLERHG LRERAQTWIG GIRAATPGRL LIAYLFVREI TAALGLTGLG       120
     GHPQMVRPLV APMAEGAALA RFGKLRDPAR FRLRAFAAAT DNVGLFFGED IFVAFGAIVL       180
     MVTFLKETGI VVEPMRVALW GMPTALAAFL VHSFRLYRLD GWLGRHAAAD EDAASANEPS       240
     VDAPGNPRRD GVVGAGQGEQ A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page