(data stored in ACNUC7421 zone)

EMBL: CP000272.PE500

CP000272.PE500       Location/Qualifiers
FT   CDS             545418..547250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0528"
FT                   /product="NAD(P)-dependent nickel-iron dehydrogenase
FT                   flavin-containing subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36428"
FT                   /db_xref="GOA:Q13HL1"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL1"
FT                   /protein_id="ABE36428.1"
FT                   /translation="MAVEPDLQLSPGPASLKSGSVDALLLRARHDPHALVQILREAQAR
FT                   HTWLSRELLGYIAGALGLTLAHVEGVATFYRFFHTSPAGEYRVLFSDNITDRMQGNAAL
FT                   LDDLCRRLGVQRGQMREDGRVSVDFCSCTGLCDQGPSLLINHHQVVTRLDAGRVAQLAE
FT                   FIESRVPAAQWPAHWFRVDDHVRRADVLLGTPLIPGAAIAAALARGVPALFDEMNRSNL
FT                   RGRGGAGFVTGMKWRLCRDAPGTEHYIVCNADEGEPGTFKDRVLLTRHPDMVVEGMTIG
FT                   ALAIGARRGMLYLRGEYRYLLEPLLDVLQRRREAHLLGASILGHAGFDFDIDIHVGAGA
FT                   YVCGEESALIESLEGKRGTPRIRPPFPAEHGYLQQPTVVDNVETLCAATHVALQGGAWW
FT                   SAIGTPKSTGTSLHSVSGDCERPGIYEYPLGTSVDRILEDCGARDTQAVQVGGPSGKCL
FT                   SAIEFGHRIAFEDVPSAGAFMVFDRSRDMFEVARNYAGFFAEESCGFCTPCRVGTALVV
FT                   KSMDKLAAGRGSRHDVELLSDIDILMHGTTHCGLGGSACNALHDTIVKFRPAYERRLKS
FT                   LEFEPAFDLDAEIEAARRVTGRDDDTVTQRESAA"
     MAVEPDLQLS PGPASLKSGS VDALLLRARH DPHALVQILR EAQARHTWLS RELLGYIAGA        60
     LGLTLAHVEG VATFYRFFHT SPAGEYRVLF SDNITDRMQG NAALLDDLCR RLGVQRGQMR       120
     EDGRVSVDFC SCTGLCDQGP SLLINHHQVV TRLDAGRVAQ LAEFIESRVP AAQWPAHWFR       180
     VDDHVRRADV LLGTPLIPGA AIAAALARGV PALFDEMNRS NLRGRGGAGF VTGMKWRLCR       240
     DAPGTEHYIV CNADEGEPGT FKDRVLLTRH PDMVVEGMTI GALAIGARRG MLYLRGEYRY       300
     LLEPLLDVLQ RRREAHLLGA SILGHAGFDF DIDIHVGAGA YVCGEESALI ESLEGKRGTP       360
     RIRPPFPAEH GYLQQPTVVD NVETLCAATH VALQGGAWWS AIGTPKSTGT SLHSVSGDCE       420
     RPGIYEYPLG TSVDRILEDC GARDTQAVQV GGPSGKCLSA IEFGHRIAFE DVPSAGAFMV       480
     FDRSRDMFEV ARNYAGFFAE ESCGFCTPCR VGTALVVKSM DKLAAGRGSR HDVELLSDID       540
     ILMHGTTHCG LGGSACNALH DTIVKFRPAY ERRLKSLEFE PAFDLDAEIE AARRVTGRDD       600
     DTVTQRESAA                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page