(data stored in ACNUC7421 zone)

EMBL: CP000272.PE501

CP000272.PE501       Location/Qualifiers
FT   CDS             547247..547987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0529"
FT                   /product="Putative NADH dehydrogenase subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36429"
FT                   /db_xref="GOA:Q13HL0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR016214"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HL0"
FT                   /protein_id="ABE36429.1"
FT                   /translation="MSTPANAGNTNGTSHAFPLDGEDVPFEPGDTILQAARRAGRYIPH
FT                   LCWHPDFHPQGSCRVCTVKVKGRPGSACTMHAADGQKVESNTDELNAERKMLLQMLFVE
FT                   GNHFCPSCEKSGNCLLQATAYEMNMEGVLFDEFYPRRPIDASHPDVMIDFNRCILCELC
FT                   VRASHDIDGKDVFAIAGHGSGTHLVVNSVSGRLADTEMDLADRATSICPVGAILPKRRG
FT                   FLIPIGERRYDPQTAADPDTQEAS"
     MSTPANAGNT NGTSHAFPLD GEDVPFEPGD TILQAARRAG RYIPHLCWHP DFHPQGSCRV        60
     CTVKVKGRPG SACTMHAADG QKVESNTDEL NAERKMLLQM LFVEGNHFCP SCEKSGNCLL       120
     QATAYEMNME GVLFDEFYPR RPIDASHPDV MIDFNRCILC ELCVRASHDI DGKDVFAIAG       180
     HGSGTHLVVN SVSGRLADTE MDLADRATSI CPVGAILPKR RGFLIPIGER RYDPQTAADP       240
     DTQEAS                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page