(data stored in ACNUC7421 zone)

EMBL: CP000272.PE506

CP000272.PE506       Location/Qualifiers
FT   CDS             550958..551860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0534"
FT                   /product="Hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36434"
FT                   /db_xref="GOA:Q13HK5"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK5"
FT                   /protein_id="ABE36434.1"
FT                   /translation="MCVVCGCGTGADPETVHADDEEAGTSHVAPTSLNGELHYGAGVAR
FT                   LSVPGMSEARAIRIETDVLDENRRHANRNRAHFASHRVTALNLVSSPGSGKTTLLCASI
FT                   EALKIRRPGFAVAVIEGDQQTSVDAERIRATGAPAIQVNTGRGCHLDAQMVGEAFAHLD
FT                   LHTAAHHARHAGAMLFIENVGNLVCPALWDLGEAAKVVVLSVTEGDDKPLKYPDMFAAA
FT                   TLMIINKIDLLPYVSFDVTRCIEYARQVNPSIDVLRVSATRGDGMDDWLGWLLPPRVEP
FT                   RFRTWKASSQRRTVLQRVR"
     MCVVCGCGTG ADPETVHADD EEAGTSHVAP TSLNGELHYG AGVARLSVPG MSEARAIRIE        60
     TDVLDENRRH ANRNRAHFAS HRVTALNLVS SPGSGKTTLL CASIEALKIR RPGFAVAVIE       120
     GDQQTSVDAE RIRATGAPAI QVNTGRGCHL DAQMVGEAFA HLDLHTAAHH ARHAGAMLFI       180
     ENVGNLVCPA LWDLGEAAKV VVLSVTEGDD KPLKYPDMFA AATLMIINKI DLLPYVSFDV       240
     TRCIEYARQV NPSIDVLRVS ATRGDGMDDW LGWLLPPRVE PRFRTWKASS QRRTVLQRVR       300
//

If you have problems or comments...

PBIL Back to PBIL home page