(data stored in SCRATCH zone)

EMBL: CP000272.PE507

CP000272.PE507       Location/Qualifiers
FT   CDS             551866..554304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0535"
FT                   /product="Hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36435"
FT                   /db_xref="GOA:Q13HK4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK4"
FT                   /protein_id="ABE36435.1"
FT                   /translation="MPTRVHTVRDDEPLVSKWGGEAIRVRGLVQGVGFRPAVWRLAHDC
FT                   GVSGTVCNDGEGVLIRAWADRPVLERFVAGLHGRCPPLGRIDSVERRAVPDVAPAPGEF
FT                   TIVESGGGPAHTGVVPDAVTCRACLDETLDPSGRRYRYPFTNCTHCGPRLSIVGAIPYD
FT                   RCATTMAAFPLCGACRREYDDPGDRRFHAQAVACPACGPRIWIEQADGSRERGDPLEVA
FT                   CRYLRLGGIVAIKGLGGFQLACMATAQAAVTKLRVLKHRARKPFALLARDVTMAERYCS
FT                   VSNADAALLRSAAGPIVIMPAIGRTTAADLSGVAPGTATLGFMLPSTPLHHLIMRALDA
FT                   PIVLTSGNVADEPQCTANDDARIRLAGMADVFLMHDREIASRIDDSVARVLHGVPRLLR
FT                   SSRGYAPAPLRMPHDFAAAPPVLAMGAQQKNAFCLLREGEALVSHHIGELENGETYRDY
FT                   KASLARYEKLFGHDARVVAVDLHPEYLSRKLGIDIARQRSLPLAEIQHHHAHFAACLAE
FT                   NDIGLASNILGVVLDGHGMGTDRRLWGGEFLLGGYVDCTRVASLTPVALPGGMRAVLEP
FT                   WRNTYAHLRASLGWEWVARRYAKLDLVRFLAGRPLALLEQMIEGGVNSPVSSSAGRLFD
FT                   AVAAAAGVCRERVQYEGQAAIEFEALIDRRTLHDEDDALAYPFRIGEASDAAYPLLIDA
FT                   KPMWLALLDDLMRATPAPVIAARFHKGFTIAIVQMVKRALGSRLHGSAPAVRTVALSGG
FT                   VMQNAALFEQLSERLAACGLVVLAHRQVPANDGGIALGQAAIAAGRALAHVEQRNTLCA
FT                   "
     MPTRVHTVRD DEPLVSKWGG EAIRVRGLVQ GVGFRPAVWR LAHDCGVSGT VCNDGEGVLI        60
     RAWADRPVLE RFVAGLHGRC PPLGRIDSVE RRAVPDVAPA PGEFTIVESG GGPAHTGVVP       120
     DAVTCRACLD ETLDPSGRRY RYPFTNCTHC GPRLSIVGAI PYDRCATTMA AFPLCGACRR       180
     EYDDPGDRRF HAQAVACPAC GPRIWIEQAD GSRERGDPLE VACRYLRLGG IVAIKGLGGF       240
     QLACMATAQA AVTKLRVLKH RARKPFALLA RDVTMAERYC SVSNADAALL RSAAGPIVIM       300
     PAIGRTTAAD LSGVAPGTAT LGFMLPSTPL HHLIMRALDA PIVLTSGNVA DEPQCTANDD       360
     ARIRLAGMAD VFLMHDREIA SRIDDSVARV LHGVPRLLRS SRGYAPAPLR MPHDFAAAPP       420
     VLAMGAQQKN AFCLLREGEA LVSHHIGELE NGETYRDYKA SLARYEKLFG HDARVVAVDL       480
     HPEYLSRKLG IDIARQRSLP LAEIQHHHAH FAACLAENDI GLASNILGVV LDGHGMGTDR       540
     RLWGGEFLLG GYVDCTRVAS LTPVALPGGM RAVLEPWRNT YAHLRASLGW EWVARRYAKL       600
     DLVRFLAGRP LALLEQMIEG GVNSPVSSSA GRLFDAVAAA AGVCRERVQY EGQAAIEFEA       660
     LIDRRTLHDE DDALAYPFRI GEASDAAYPL LIDAKPMWLA LLDDLMRATP APVIAARFHK       720
     GFTIAIVQMV KRALGSRLHG SAPAVRTVAL SGGVMQNAAL FEQLSERLAA CGLVVLAHRQ       780
     VPANDGGIAL GQAAIAAGRA LAHVEQRNTL CA                                     812
//

If you have problems or comments...

PBIL Back to PBIL home page