(data stored in SCRATCH zone)

EMBL: CP000272.PE508

CP000272.PE508       Location/Qualifiers
FT   CDS             554295..554597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0536"
FT                   /product="Hydrogenase expression/formation protein,
FT                   HupF/HypC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36436"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK3"
FT                   /protein_id="ABE36436.1"
FT                   /translation="MCLGIPGQIIAIHDAVNKLALVEVSGVRRLINIAFIVDEDLPAAA
FT                   YVGDWVLIHVGFAMSRLDEAEAMHTLALLRELGESDELDDRRIATDAFSATGSTP"
     MCLGIPGQII AIHDAVNKLA LVEVSGVRRL INIAFIVDED LPAAAYVGDW VLIHVGFAMS        60
     RLDEAEAMHT LALLRELGES DELDDRRIAT DAFSATGSTP                             100
//

If you have problems or comments...

PBIL Back to PBIL home page