(data stored in SCRATCH zone)

EMBL: CP000272.PE509

CP000272.PE509       Location/Qualifiers
FT   CDS             554594..555784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0537"
FT                   /product="Hydrogenase formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36437"
FT                   /db_xref="GOA:Q13HK2"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HK2"
FT                   /protein_id="ABE36437.1"
FT                   /translation="MKYVDEFRDPDRARALTHEIRRLVERIARTRGGLERPLQIMEVCG
FT                   GHTHSIFRYGIHQMLPPEVEFVHGPGCPVCVLPMGRVDDCVALARRPEVIFTTFGDAMR
FT                   VPGSSTSLLKAKADGADVRMVYSPVDALAIARANPHREVIFFGLGFETTMPGTAMTVLQ
FT                   AHAGRVENFSLFCNHITIVPTIKAILDSPDLRLDGFLGPGHVSMVIGTRPYRFIAEQYR
FT                   RPITVAGFEPLDVLHSVFMVLRQIAEGRSEVENQYARIVPENGNAQALSAIGQVFEPRE
FT                   FFEWRGLGSIEHSGVRIRDAFAAFDAERKFPVANLQLADPQACQCGEVLKGVIKPPQCK
FT                   VFGTACTPDRPLGALMVSSEGACAAHYRYARIDTSALTAAAAVCPGPAPAALRVQA"
     MKYVDEFRDP DRARALTHEI RRLVERIART RGGLERPLQI MEVCGGHTHS IFRYGIHQML        60
     PPEVEFVHGP GCPVCVLPMG RVDDCVALAR RPEVIFTTFG DAMRVPGSST SLLKAKADGA       120
     DVRMVYSPVD ALAIARANPH REVIFFGLGF ETTMPGTAMT VLQAHAGRVE NFSLFCNHIT       180
     IVPTIKAILD SPDLRLDGFL GPGHVSMVIG TRPYRFIAEQ YRRPITVAGF EPLDVLHSVF       240
     MVLRQIAEGR SEVENQYARI VPENGNAQAL SAIGQVFEPR EFFEWRGLGS IEHSGVRIRD       300
     AFAAFDAERK FPVANLQLAD PQACQCGEVL KGVIKPPQCK VFGTACTPDR PLGALMVSSE       360
     GACAAHYRYA RIDTSALTAA AAVCPGPAPA ALRVQA                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page