(data stored in ACNUC7421 zone)

EMBL: CP000272.PE512

CP000272.PE512       Location/Qualifiers
FT   CDS             complement(557620..558144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ9"
FT                   /protein_id="ABE36440.1"
FT                   /translation="MRPAAILTGKLDVLFGTRPDCLTASCTDDSPYDARNGPECRYGPV
FT                   PRRFNRDDGATSRRNALHLRAVAMPSYLLTLASTLAGIRGAATRAHNTPGAHGSPRRDT
FT                   PASSPLRGGTRIAQRQQSLLDVGKPGIGDLSVKLHRLNQKLNVDVLAFRSEIVELREYS
FT                   LVGIGVHGRSL"
     MRPAAILTGK LDVLFGTRPD CLTASCTDDS PYDARNGPEC RYGPVPRRFN RDDGATSRRN        60
     ALHLRAVAMP SYLLTLASTL AGIRGAATRA HNTPGAHGSP RRDTPASSPL RGGTRIAQRQ       120
     QSLLDVGKPG IGDLSVKLHR LNQKLNVDVL AFRSEIVELR EYSLVGIGVH GRSL             174
//

If you have problems or comments...

PBIL Back to PBIL home page